Lineage for d3vwxc2 (3vwx C:88-222)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714003Species House fly (Musca domestica) [TaxId:7370] [226606] (2 PDB entries)
  8. 2714006Domain d3vwxc2: 3vwx C:88-222 [218137]
    Other proteins in same PDB: d3vwxa1, d3vwxb1, d3vwxc1, d3vwxd1
    automated match to d1r5aa1
    complexed with gsh

Details for d3vwxc2

PDB Entry: 3vwx (more details), 1.8 Å

PDB Description: Structural analysis of an epsilon-class glutathione S-transferase from housefly, Musca domestica
PDB Compounds: (C:) Glutathione s-transferase 6B

SCOPe Domain Sequences for d3vwxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vwxc2 a.45.1.0 (C:88-222) automated matches {House fly (Musca domestica) [TaxId: 7370]}
kdllkravvdqrmyfeagvlfqgglrnitaplffrnqtqipqhqidsivesygflesflk
nnkymagdhltiadfsivtsvtslvafaeidqskfpklsawlkslqslpfyeeangagak
qlvamvksknltivp

SCOPe Domain Coordinates for d3vwxc2:

Click to download the PDB-style file with coordinates for d3vwxc2.
(The format of our PDB-style files is described here.)

Timeline for d3vwxc2: