![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species House fly (Musca domestica) [TaxId:7370] [226606] (2 PDB entries) |
![]() | Domain d3vwxc2: 3vwx C:88-222 [218137] Other proteins in same PDB: d3vwxa1, d3vwxb1, d3vwxc1, d3vwxd1 automated match to d1r5aa1 complexed with gsh |
PDB Entry: 3vwx (more details), 1.8 Å
SCOPe Domain Sequences for d3vwxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vwxc2 a.45.1.0 (C:88-222) automated matches {House fly (Musca domestica) [TaxId: 7370]} kdllkravvdqrmyfeagvlfqgglrnitaplffrnqtqipqhqidsivesygflesflk nnkymagdhltiadfsivtsvtslvafaeidqskfpklsawlkslqslpfyeeangagak qlvamvksknltivp
Timeline for d3vwxc2: