SCOPe 2.07: Domain d3vwxb1: 3vwx B:3-87

Lineage for d3vwxb1 (3vwx B:3-87)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species House fly (Musca domestica) [TaxId:7370] [226605] (2 PDB entries)

8. Domain d3vwxb1: 3vwx B:3-87 [218134]
   Other proteins in same PDB: d3vwxa2, d3vwxb2, d3vwxc2, d3vwxd2
   automated match to d1r5aa2
   complexed with gsh

Details for d3vwxb1

PDB Entry: 3vwx, 1.8 Å

PDB Description: Structural analysis of an epsilon-class glutathione S-transferase from housefly, Musca domestica

PDB Compounds: (B:) Glutathione s-transferase 6B

SCOPe Domain Sequences for d3vwxb1:

Sequence; same for both SEQRES and ATOM records:

>d3vwxb1 c.47.1.0 (B:3-87) automated matches {House fly (Musca domestica) [TaxId: 7370]}
klvlygidpsppvraclltlkalnlpfeykvvnlfakehlseeylkknpqhtvptleedg
hliwdshaimaylvskygkddslyp

Timeline for d3vwxb1:

• d3vwxb1 first appeared in SCOPe 2.03
  
• d3vwxb1 appears in SCOPe 2.06
  
• d3vwxb1 appears in the current release, SCOPe 2.08