Lineage for d3vwxa1 (3vwx A:3-87)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879604Species House fly (Musca domestica) [TaxId:7370] [226605] (2 PDB entries)
  8. 2879605Domain d3vwxa1: 3vwx A:3-87 [218132]
    Other proteins in same PDB: d3vwxa2, d3vwxb2, d3vwxc2, d3vwxd2
    automated match to d1r5aa2
    complexed with gsh

Details for d3vwxa1

PDB Entry: 3vwx (more details), 1.8 Å

PDB Description: Structural analysis of an epsilon-class glutathione S-transferase from housefly, Musca domestica
PDB Compounds: (A:) Glutathione s-transferase 6B

SCOPe Domain Sequences for d3vwxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vwxa1 c.47.1.0 (A:3-87) automated matches {House fly (Musca domestica) [TaxId: 7370]}
klvlygidpsppvraclltlkalnlpfeykvvnlfakehlseeylkknpqhtvptleedg
hliwdshaimaylvskygkddslyp

SCOPe Domain Coordinates for d3vwxa1:

Click to download the PDB-style file with coordinates for d3vwxa1.
(The format of our PDB-style files is described here.)

Timeline for d3vwxa1: