Lineage for d1c7ta1 (1c7t A:781-885)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54529Protein Bacterial chitobiase, c-terminal domain [49211] (1 species)
  7. 54530Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries)
  8. 54534Domain d1c7ta1: 1c7t A:781-885 [21813]
    Other proteins in same PDB: d1c7ta2, d1c7ta3, d1c7ta4

Details for d1c7ta1

PDB Entry: 1c7t (more details), 1.9 Å

PDB Description: beta-n-acetylhexosaminidase mutant e540d complexed with di-n acetyl-d- glucosamine (chitobiase)

SCOP Domain Sequences for d1c7ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ta1 b.1.1.5 (A:781-885) Bacterial chitobiase, c-terminal domain {Serratia marcescens}
gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl
gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv

SCOP Domain Coordinates for d1c7ta1:

Click to download the PDB-style file with coordinates for d1c7ta1.
(The format of our PDB-style files is described here.)

Timeline for d1c7ta1: