Lineage for d3vwka2 (3vwk A:184-277)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1514356Protein CD1, alpha-3 domain [88615] (5 species)
  7. Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries)
  8. 1514370Domain d3vwka2: 3vwk A:184-277 [218126]
    Other proteins in same PDB: d3vwka1, d3vwkb_, d3vwkc1, d3vwkc2, d3vwkd1, d3vwkd2
    automated match to d1onqa1
    complexed with 4gh, mg, nag

Details for d3vwka2

PDB Entry: 3vwk (more details), 2.94 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3vwka2:

Sequence, based on SEQRES records: (download)

>d3vwka2 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

Sequence, based on observed residues (ATOM records): (download)

>d3vwka2 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpkawlsrgpspgrlllvchvsgfypkpvwvkwmtqpgdilpnadetwylratldvls
crvkhsslegqdivlyw

SCOPe Domain Coordinates for d3vwka2:

Click to download the PDB-style file with coordinates for d3vwka2.
(The format of our PDB-style files is described here.)

Timeline for d3vwka2: