SCOPe 2.04: Domain d3vwka2: 3vwk A:184-277

Lineage for d3vwka2 (3vwk A:184-277)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries)

8. Domain d3vwka2: 3vwk A:184-277 [218126]
   Other proteins in same PDB: d3vwka1, d3vwkb_, d3vwkc1, d3vwkc2, d3vwkd1, d3vwkd2
   automated match to d1onqa1
   complexed with 4gh, mg, nag

Details for d3vwka2

PDB Entry: 3vwk, 2.94 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-4'deoxy-alpha- galactosylceramide complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3vwka2:

Sequence, based on SEQRES records:

>d3vwka2 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

Sequence, based on observed residues (ATOM records):

>d3vwka2 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpkawlsrgpspgrlllvchvsgfypkpvwvkwmtqpgdilpnadetwylratldvls
crvkhsslegqdivlyw

Timeline for d3vwka2:

• d3vwka2 first appeared in SCOPe 2.03
  
• d3vwka2 appears in SCOPe 2.05
  
• d3vwka2 appears in the current release, SCOPe 2.08