Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain [49211] (1 species) rudiment form of Ig-like domain; follows the catalytic (beta/alpha)8-barrel domain; family 20 glycosyl hydrolases |
Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries) |
Domain d1c7sa1: 1c7s A:781-885 [21812] Other proteins in same PDB: d1c7sa2, d1c7sa3, d1c7sa4 complexed with cbs, so4; mutant |
PDB Entry: 1c7s (more details), 1.8 Å
SCOP Domain Sequences for d1c7sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7sa1 b.1.18.2 (A:781-885) Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain {Serratia marcescens} gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv
Timeline for d1c7sa1: