SCOPe 2.03: Domain d3vv0a2: 3vv0 A:194-362

Lineage for d3vv0a2 (3vv0 A:194-362)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
   contains metal-binding preSET and postSET domains

6. Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82206] (17 PDB entries)
   Uniprot Q8WTS6 52-336

8. Domain d3vv0a2: 3vv0 A:194-362 [218118]
   Other proteins in same PDB: d3vv0a1
   automated match to d3cbpa2
   complexed with kh3

Details for d3vv0a2

PDB Entry: 3vv0, 2 Å

PDB Description: crystal structure of histone methyltransferase set7/9 in complex with daam-3

PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d3vv0a2:

Sequence, based on SEQRES records:

>d3vv0a2 b.85.7.1 (A:194-362) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqa

Sequence, based on observed residues (ATOM records):

>d3vv0a2 b.85.7.1 (A:194-362) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygypewyqvelkafqa

Timeline for d3vv0a2:

• d3vv0a2 is new in SCOPe 2.03-stable
  
• d3vv0a2 appears in SCOPe 2.04
  
• d3vv0a2 appears in the current release, SCOPe 2.08