SCOPe 2.03: Domain d3vv0a1: 3vv0 A:116-193

Lineage for d3vv0a1 (3vv0 A:116-193)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family)
   11+ stranded sheet partly folded upon itself at the C-end

5. Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)

6. Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82188] (17 PDB entries)
   Uniprot Q8WTS6 52-366

8. Domain d3vv0a1: 3vv0 A:116-193 [218117]
   Other proteins in same PDB: d3vv0a2
   automated match to d1n6ca1
   complexed with kh3

Details for d3vv0a1

PDB Entry: 3vv0, 2 Å

PDB Description: crystal structure of histone methyltransferase set7/9 in complex with daam-3

PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d3vv0a1:

Sequence; same for both SEQRES and ATOM records:

>d3vv0a1 b.76.2.1 (A:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
eegrphfelmpgnsvyhf

Timeline for d3vv0a1:

• d3vv0a1 is new in SCOPe 2.03-stable
  
• d3vv0a1 appears in SCOPe 2.04
  
• d3vv0a1 appears in the current release, SCOPe 2.08