| Class b: All beta proteins [48724] (180 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) ![]() duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core Pfam PF00856 |
| Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins) contains metal-binding preSET (Pfam PF05033) or AWS (Associated With SET, Pfam PF17907), and postSET domains |
| Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries) Uniprot Q8WTS6 52-336 |
| Domain d3vuza2: 3vuz A:194-362 [218116] Other proteins in same PDB: d3vuza1, d3vuza3 automated match to d3cbpa2 complexed with k15 |
PDB Entry: 3vuz (more details), 2.5 Å
SCOPe Domain Sequences for d3vuza2:
Sequence, based on SEQRES records: (download)
>d3vuza2 b.85.7.1 (A:194-362) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqa
>d3vuza2 b.85.7.1 (A:194-362) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydheapewyqvelkafqa
Timeline for d3vuza2: