Lineage for d3vuza1 (3vuz A:1-193)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329352Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 1329380Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 1329381Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 1329382Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 1329383Species Human (Homo sapiens) [TaxId:9606] [82188] (17 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 1329402Domain d3vuza1: 3vuz A:1-193 [218115]
    Other proteins in same PDB: d3vuza2
    automated match to d1n6ca1
    complexed with k15

Details for d3vuza1

PDB Entry: 3vuz (more details), 2.5 Å

PDB Description: crystal structure of histone methyltransferase set7/9 in complex with aam-1
PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d3vuza1:

Sequence, based on SEQRES records: (download)

>d3vuza1 b.76.2.1 (A:1-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidge
miegklatlmsteegrphfelmpgnsvyhf

Sequence, based on observed residues (ATOM records): (download)

>d3vuza1 b.76.2.1 (A:1-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gssgssghgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegk
latlmsteegrphfelmpgnsvyhf

SCOPe Domain Coordinates for d3vuza1:

Click to download the PDB-style file with coordinates for d3vuza1.
(The format of our PDB-style files is described here.)

Timeline for d3vuza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vuza2