Lineage for d1qbba1 (1qbb A:781-885)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789056Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 789063Protein Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain [49211] (1 species)
    rudiment form of Ig-like domain; follows the catalytic (beta/alpha)8-barrel domain; family 20 glycosyl hydrolases
  7. 789064Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries)
  8. 789067Domain d1qbba1: 1qbb A:781-885 [21811]
    Other proteins in same PDB: d1qbba2, d1qbba3, d1qbba4
    complexed with cbs, so4

Details for d1qbba1

PDB Entry: 1qbb (more details), 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)
PDB Compounds: (A:) chitobiase

SCOP Domain Sequences for d1qbba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbba1 b.1.18.2 (A:781-885) Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain {Serratia marcescens [TaxId: 615]}
gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl
gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv

SCOP Domain Coordinates for d1qbba1:

Click to download the PDB-style file with coordinates for d1qbba1.
(The format of our PDB-style files is described here.)

Timeline for d1qbba1: