Lineage for d1qbb_1 (1qbb 781-885)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223308Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
  6. 223315Protein Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain [49211] (1 species)
    rudiment form of Ig-like domain; follows the catalytic (beta/alpha)8-barrel domain; family 20 glycosyl hydrolases
  7. 223316Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries)
  8. 223319Domain d1qbb_1: 1qbb 781-885 [21811]
    Other proteins in same PDB: d1qbb_2, d1qbb_3, d1qbb_4
    complexed with cbs, so4

Details for d1qbb_1

PDB Entry: 1qbb (more details), 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)

SCOP Domain Sequences for d1qbb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbb_1 b.1.18.2 (781-885) Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain {Serratia marcescens}
gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl
gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv

SCOP Domain Coordinates for d1qbb_1:

Click to download the PDB-style file with coordinates for d1qbb_1.
(The format of our PDB-style files is described here.)

Timeline for d1qbb_1: