Lineage for d1qbb_1 (1qbb 781-885)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54529Protein Bacterial chitobiase, c-terminal domain [49211] (1 species)
  7. 54530Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries)
  8. 54533Domain d1qbb_1: 1qbb 781-885 [21811]
    Other proteins in same PDB: d1qbb_2, d1qbb_3, d1qbb_4

Details for d1qbb_1

PDB Entry: 1qbb (more details), 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)

SCOP Domain Sequences for d1qbb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbb_1 b.1.1.5 (781-885) Bacterial chitobiase, c-terminal domain {Serratia marcescens}
gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl
gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv

SCOP Domain Coordinates for d1qbb_1:

Click to download the PDB-style file with coordinates for d1qbb_1.
(The format of our PDB-style files is described here.)

Timeline for d1qbb_1: