![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries) |
![]() | Domain d3vura2: 3vur A:76-203 [218105] Other proteins in same PDB: d3vura1 automated match to d1m0ua1 complexed with 1pe, gts |
PDB Entry: 3vur (more details), 1.36 Å
SCOPe Domain Sequences for d3vura2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vura2 a.45.1.0 (A:76-203) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} lagandeeafeidqnveflndirasaasvhyekdeavkakkkaeleetkypfffeklnei ltknnghialgkltwgdfvyagmydylkamlqkpdleqkypafrkpieavlaipkvkayv daaprtel
Timeline for d3vura2: