Lineage for d3vura1 (3vur A:1-75)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880286Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (9 PDB entries)
  8. 2880287Domain d3vura1: 3vur A:1-75 [218104]
    Other proteins in same PDB: d3vura2
    automated match to d1m0ua2
    complexed with 1pe, gts

Details for d3vura1

PDB Entry: 3vur (more details), 1.36 Å

PDB Description: Crystal structure of Bombyx mori sigma-class glutathione transferase in complex with glutathionesulfonic acid
PDB Compounds: (A:) Glutathione S-transferase sigma

SCOPe Domain Sequences for d3vura1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vura1 c.47.1.0 (A:1-75) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
pnvkfyyfpvkalgesqrlllayggqefednrissenwpefkpktpfgqmpvleidgkqy
aqstaicrylgrkyg

SCOPe Domain Coordinates for d3vura1:

Click to download the PDB-style file with coordinates for d3vura1.
(The format of our PDB-style files is described here.)

Timeline for d3vura1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vura2