SCOPe 2.08: Domain d3vura1: 3vur A:1-75

Lineage for d3vura1 (3vur A:1-75)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (9 PDB entries)

8. Domain d3vura1: 3vur A:1-75 [218104]
   Other proteins in same PDB: d3vura2
   automated match to d1m0ua2
   complexed with 1pe, gts

Details for d3vura1

PDB Entry: 3vur, 1.36 Å

PDB Description: Crystal structure of Bombyx mori sigma-class glutathione transferase in complex with glutathionesulfonic acid

PDB Compounds: (A:) Glutathione S-transferase sigma

SCOPe Domain Sequences for d3vura1:

Sequence; same for both SEQRES and ATOM records:

>d3vura1 c.47.1.0 (A:1-75) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
pnvkfyyfpvkalgesqrlllayggqefednrissenwpefkpktpfgqmpvleidgkqy
aqstaicrylgrkyg

Timeline for d3vura1:

• d3vura1 first appeared in SCOPe 2.03
  
• d3vura1 appears in SCOPe 2.07