SCOP 1.67: Domain d1qba_1: 1qba 781-885

Lineage for d1qba_1 (1qba 781-885)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain [49211] (1 species)
   rudiment form of Ig-like domain; follows the catalytic (beta/alpha)8-barrel domain; family 20 glycosyl hydrolases

7. Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries)

8. Domain d1qba_1: 1qba 781-885 [21810]
   Other proteins in same PDB: d1qba_2, d1qba_3, d1qba_4
   complexed with so4

Details for d1qba_1

PDB Entry: 1qba, 1.85 Å

PDB Description: bacterial chitobiase, glycosyl hydrolase family 20

SCOP Domain Sequences for d1qba_1:

Sequence; same for both SEQRES and ATOM records:

>d1qba_1 b.1.18.2 (781-885) Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain {Serratia marcescens}
gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl
gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv

Timeline for d1qba_1:

• d1qba_1 first appeared (with stable ids) in SCOP 1.55
  
• d1qba_1 appears in SCOP 1.65
  
• d1qba_1 appears in SCOP 1.69
  
• d1qba_1 appears in the current release, SCOPe 2.08, called d1qbaa1