| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Hemapoetic cell kinase Hck [50062] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries) |
| Domain d3vs6a1: 3vs6 A:86-146 [218094] Other proteins in same PDB: d3vs6a2, d3vs6a3, d3vs6a4, d3vs6b2, d3vs6b3, d3vs6b4 automated match to d1qcfa1 complexed with ca, cl, vsh |
PDB Entry: 3vs6 (more details), 2.37 Å
SCOPe Domain Sequences for d3vs6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vs6a1 b.34.2.1 (A:86-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t
Timeline for d3vs6a1:
View in 3DDomains from other chains: (mouse over for more information) d3vs6b1, d3vs6b2, d3vs6b3, d3vs6b4 |