Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Haemopoetic cell kinase Hck [56151] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56152] (24 PDB entries) |
Domain d3vs5a3: 3vs5 A:250-531 [218090] Other proteins in same PDB: d3vs5a1, d3vs5a2, d3vs5a4, d3vs5b1, d3vs5b2, d3vs5b4 automated match to d1qcfa3 complexed with ca, vsg |
PDB Entry: 3vs5 (more details), 2.85 Å
SCOPe Domain Sequences for d3vs5a3:
Sequence, based on SEQRES records: (download)
>d3vs5a3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip
>d3vs5a3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainfgsftik sdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknr peerptfeyiqsvlddfytatesqyeeip
Timeline for d3vs5a3:
View in 3D Domains from other chains: (mouse over for more information) d3vs5b1, d3vs5b2, d3vs5b3, d3vs5b4 |