![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Galactose oxidase, C-terminal domain [49209] (3 species) follows the catalytic seven-bladed beta-propeller domain |
![]() | Species Dactylium dendroides [TaxId:5132] [49210] (4 PDB entries) Uniprot Q01745 42-680 |
![]() | Domain d1goha1: 1goh A:538-639 [21809] Other proteins in same PDB: d1goha2, d1goha3 complexed with na |
PDB Entry: 1goh (more details), 2.2 Å
SCOPe Domain Sequences for d1goha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goha1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides [TaxId: 5132]} gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
Timeline for d1goha1: