Lineage for d1goh_1 (1goh 538-639)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (24 proteins) 
Protein Galactose oxidase, C-terminal domain [49209] (1 species) Species Dactylium dendroides [TaxId:5132] [49210] (3 PDB entries) 
Domain d1goh_1: 1goh 538-639 [21809]
Other proteins in same PDB: d1goh_2, d1goh_3
Details for d1goh_1
PDB Entry: 1goh (more details), 2.2 Å
PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase
SCOP Domain Sequences for d1goh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goh_1 b.1.1.5 (538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
SCOP Domain Coordinates for d1goh_1:
Click to download the PDB-style file with coordinates for d1goh_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1goh_1:
- d1goh_1 first appeared (with stable ids) in SCOP 1.55
- d1goh_1 appears in SCOP 1.59
- d1goh_1 appears in the current release, SCOPe 2.08, called d1goha1
View in 3D
