Lineage for d1goh_1 (1goh 538-639)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9671Protein Galactose oxidase, C-terminal domain [49209] (1 species)
  7. 9672Species Dactylium dendroides [TaxId:5132] [49210] (3 PDB entries)
  8. 9675Domain d1goh_1: 1goh 538-639 [21809]
    Other proteins in same PDB: d1goh_2, d1goh_3

Details for d1goh_1

PDB Entry: 1goh (more details), 2.2 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

SCOP Domain Sequences for d1goh_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goh_1 b.1.1.5 (538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOP Domain Coordinates for d1goh_1:

Click to download the PDB-style file with coordinates for d1goh_1.
(The format of our PDB-style files is described here.)

Timeline for d1goh_1: