Lineage for d3vs4a3 (3vs4 A:250-531)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930589Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 1930590Species Human (Homo sapiens) [TaxId:9606] [56152] (19 PDB entries)
  8. 1930609Domain d3vs4a3: 3vs4 A:250-531 [218084]
    Other proteins in same PDB: d3vs4a1, d3vs4a2, d3vs4b1, d3vs4b2
    automated match to d1qcfa3
    complexed with ca, cl, vsf

Details for d3vs4a3

PDB Entry: 3vs4 (more details), 2.75 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 5-(4-phenoxyphenyl)-7-(tetrahydro-2H-pyran-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs4a3:

Sequence, based on SEQRES records: (download)

>d3vs4a3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Sequence, based on observed residues (ATOM records): (download)

>d3vs4a3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviefpikwtapeainfgsft
iksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwk
nrpeerptfeyiqsvlddfytatesqyeeip

SCOPe Domain Coordinates for d3vs4a3:

Click to download the PDB-style file with coordinates for d3vs4a3.
(The format of our PDB-style files is described here.)

Timeline for d3vs4a3: