SCOP 1.71: Domain d1gog_1: 1gog 538-639

Lineage for d1gog_1 (1gog 538-639)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Galactose oxidase, C-terminal domain [49209] (2 species)
   follows the catalytic seven-bladed beta-propeller domain

7. Species Dactylium dendroides [TaxId:5132] [49210] (4 PDB entries)

8. Domain d1gog_1: 1gog 538-639 [21808]
   Other proteins in same PDB: d1gog_2, d1gog_3
   complexed with cu, na

Details for d1gog_1

PDB Entry: 1gog, 1.9 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

SCOP Domain Sequences for d1gog_1:

Sequence; same for both SEQRES and ATOM records:

>d1gog_1 b.1.18.2 (538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

Timeline for d1gog_1:

• d1gog_1 first appeared (with stable ids) in SCOP 1.55
  
• d1gog_1 appears in SCOP 1.69
  
• d1gog_1 is called d1goga1 in SCOP 1.73
  
• d1gog_1 appears in the current release, SCOPe 2.08, called d1goga1