Lineage for d1gog_1 (1gog 538-639)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54611Protein Galactose oxidase, C-terminal domain [49209] (1 species)
  7. 54612Species Dactylium dendroides [TaxId:5132] [49210] (3 PDB entries)
  8. 54614Domain d1gog_1: 1gog 538-639 [21808]
    Other proteins in same PDB: d1gog_2, d1gog_3

Details for d1gog_1

PDB Entry: 1gog (more details), 1.9 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

SCOP Domain Sequences for d1gog_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gog_1 b.1.1.5 (538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOP Domain Coordinates for d1gog_1:

Click to download the PDB-style file with coordinates for d1gog_1.
(The format of our PDB-style files is described here.)

Timeline for d1gog_1: