Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Hemopoetic cell kinase Hck [55565] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55566] (17 PDB entries) |
Domain d3vs3a2: 3vs3 A:147-249 [218077] Other proteins in same PDB: d3vs3a1, d3vs3a3, d3vs3b1, d3vs3b3 automated match to d1qcfa2 complexed with ca, cl, vse |
PDB Entry: 3vs3 (more details), 2.17 Å
SCOPe Domain Sequences for d3vs3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vs3a2 d.93.1.1 (A:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d3vs3a2: