![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein Hemapoetic cell kinase Hck [50062] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries) |
![]() | Domain d3vs3a1: 3vs3 A:86-146 [218076] Other proteins in same PDB: d3vs3a2, d3vs3a3, d3vs3a4, d3vs3b2, d3vs3b3, d3vs3b4 automated match to d1qcfa1 complexed with ca, cl, vse |
PDB Entry: 3vs3 (more details), 2.17 Å
SCOPe Domain Sequences for d3vs3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vs3a1 b.34.2.1 (A:86-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle t
Timeline for d3vs3a1:
![]() Domains from other chains: (mouse over for more information) d3vs3b1, d3vs3b2, d3vs3b3, d3vs3b4 |