Lineage for d1gof_1 (1gof 538-639)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456196Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (17 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 456298Protein Galactose oxidase, C-terminal domain [49209] (2 species)
    follows the catalytic seven-bladed beta-propeller domain
  7. 456299Species Dactylium dendroides [TaxId:5132] [49210] (4 PDB entries)
  8. 456300Domain d1gof_1: 1gof 538-639 [21807]
    Other proteins in same PDB: d1gof_2, d1gof_3

Details for d1gof_1

PDB Entry: 1gof (more details), 1.7 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

SCOP Domain Sequences for d1gof_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gof_1 b.1.18.2 (538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOP Domain Coordinates for d1gof_1:

Click to download the PDB-style file with coordinates for d1gof_1.
(The format of our PDB-style files is described here.)

Timeline for d1gof_1: