SCOPe 2.03: Domain d3vs0b3: 3vs0 B:250-531

Lineage for d3vs0b3 (3vs0 B:250-531)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (17 PDB entries)

8. Domain d3vs0b3: 3vs0 B:250-531 [218063]
   Other proteins in same PDB: d3vs0a1, d3vs0a2, d3vs0b1, d3vs0b2
   automated match to d1qcfa3
   complexed with ca, cl, vs0

Details for d3vs0b3

PDB Entry: 3vs0, 2.93 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor N-[4-(4-amino-7-cyclopentyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)phenyl]benzamide

PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs0b3:

Sequence, based on SEQRES records:

>d3vs0b3 d.144.1.7 (B:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Sequence, based on observed residues (ATOM records):

>d3vs0b3 d.144.1.7 (B:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainfgsftik
sdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknr
peerptfeyiqsvlddfytatesqyeeip

Timeline for d3vs0b3:

• d3vs0b3 is new in SCOPe 2.03-stable
  
• d3vs0b3 appears in SCOPe 2.04
  
• d3vs0b3 appears in the current release, SCOPe 2.08