Lineage for d1g0xa2 (1g0x A:98-198)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54416Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
  7. 54417Species Human (Homo sapiens) [TaxId:9606] [49207] (1 PDB entry)
  8. 54419Domain d1g0xa2: 1g0x A:98-198 [21806]

Details for d1g0xa2

PDB Entry: 1g0x (more details), 2.1 Å

PDB Description: crystal structure of the ligand binding domain of lir-1 (ilt2)

SCOP Domain Sequences for d1g0xa2:

Sequence, based on SEQRES records: (download)

>d1g0xa2 b.1.1.4 (A:98-198) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens)}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckegedehpqclnsqphargssra
ifsvgpvspsrrwwyrcyaydsnspyewslpsdllellvlg

Sequence, based on observed residues (ATOM records): (download)

>d1g0xa2 b.1.1.4 (A:98-198) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens)}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckegehpqclnsqphargssraif
svgpvspsrrwwyrcyaydsnspyewslpsdllellvlg

SCOP Domain Coordinates for d1g0xa2:

Click to download the PDB-style file with coordinates for d1g0xa2.
(The format of our PDB-style files is described here.)

Timeline for d1g0xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g0xa1