Lineage for d3vs0a1 (3vs0 A:86-146)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783072Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 2783073Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries)
  8. 2783110Domain d3vs0a1: 3vs0 A:86-146 [218058]
    Other proteins in same PDB: d3vs0a2, d3vs0a3, d3vs0a4, d3vs0b2, d3vs0b3, d3vs0b4
    automated match to d1qcfa1
    complexed with ca, cl, vs0

Details for d3vs0a1

PDB Entry: 3vs0 (more details), 2.93 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor N-[4-(4-amino-7-cyclopentyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)phenyl]benzamide
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vs0a1 b.34.2.1 (A:86-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t

SCOPe Domain Coordinates for d3vs0a1:

Click to download the PDB-style file with coordinates for d3vs0a1.
(The format of our PDB-style files is described here.)

Timeline for d3vs0a1: