Lineage for d1g0xa1 (1g0x A:2-97)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (21 proteins) 
Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49207] (1 PDB entry) 
Domain d1g0xa1: 1g0x A:2-97 [21805]
Details for d1g0xa1
PDB Entry: 1g0x (more details), 2.1 Å
PDB Description: crystal structure of the ligand binding domain of lir-1 (ilt2)
SCOP Domain Sequences for d1g0xa1:
Sequence, based on SEQRES records: (download)
>d1g0xa1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens)}
hlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqfp
ipsitwehagryrcyygsdtagrsessdplelvvtg
Sequence, based on observed residues (ATOM records): (download)
>d1g0xa1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens)}
hlpkptlwaepgsvitqgspvtlrcqgtqeyrlyrekktapwitripqelvkkgqfpips
itwehagryrcyygsdtagrsessdplelvvtg
SCOP Domain Coordinates for d1g0xa1:
Click to download the PDB-style file with coordinates for d1g0xa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g0xa1:
- d1g0xa1 appears in SCOP 1.57
- d1g0xa1 appears in the current release, SCOPe 2.08
View in 3D
