SCOPe 2.03: Domain d3vrda2: 3vrd A:81-174

Lineage for d3vrda2 (3vrd A:81-174)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
   duplication: consists of two cytochrome c type domains

6. Protein automated matches [227089] (1 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [226470] (1 PDB entry)

8. Domain d3vrda2: 3vrd A:81-174 [218045]
   automated match to d1fcdc2
   complexed with fad, gol, hec, no3

Details for d3vrda2

PDB Entry: 3vrd, 1.5 Å

PDB Description: crystal structure of flavocytochrome c from thermochromatium tepidum

PDB Compounds: (A:) Flavocytochrome c heme subunit

SCOPe Domain Sequences for d3vrda2:

Sequence; same for both SEQRES and ATOM records:

>d3vrda2 a.3.1.4 (A:81-174) automated matches {Thermochromatium tepidum [TaxId: 1050]}
vkqsfdkalvakgtklhdkycekchvesgkpladqdeyhilagqwtpylryaiedfraer
rpmekkmasklkellkaegedgldalfafyasqq

Timeline for d3vrda2:

• d3vrda2 is new in SCOPe 2.03-stable
  
• d3vrda2 appears in SCOPe 2.04
  
• d3vrda2 appears in the current release, SCOPe 2.08