Lineage for d3vrda1 (3vrd A:1-80)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257655Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
    duplication: consists of two cytochrome c type domains
  6. 1257689Protein automated matches [227089] (1 species)
    not a true protein
  7. 1257690Species Thermochromatium tepidum [TaxId:1050] [226470] (1 PDB entry)
  8. 1257691Domain d3vrda1: 3vrd A:1-80 [218044]
    automated match to d1fcdc1
    complexed with fad, gol, hec, no3

Details for d3vrda1

PDB Entry: 3vrd (more details), 1.5 Å

PDB Description: crystal structure of flavocytochrome c from thermochromatium tepidum
PDB Compounds: (A:) Flavocytochrome c heme subunit

SCOPe Domain Sequences for d3vrda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vrda1 a.3.1.4 (A:1-80) automated matches {Thermochromatium tepidum [TaxId: 1050]}
eptaemlanncagchgtrgnsagpaspsiaqmdpavfvevmeqfksgeiqstimgriakg
ystadfqkmaeyfkqqtyqp

SCOPe Domain Coordinates for d3vrda1:

Click to download the PDB-style file with coordinates for d3vrda1.
(The format of our PDB-style files is described here.)

Timeline for d3vrda1: