![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins) duplication: consists of two cytochrome c type domains |
![]() | Protein automated matches [227089] (1 species) not a true protein |
![]() | Species Thermochromatium tepidum [TaxId:1050] [226470] (1 PDB entry) |
![]() | Domain d3vrda1: 3vrd A:1-80 [218044] automated match to d1fcdc1 complexed with fad, gol, hec, no3 |
PDB Entry: 3vrd (more details), 1.5 Å
SCOPe Domain Sequences for d3vrda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vrda1 a.3.1.4 (A:1-80) automated matches {Thermochromatium tepidum [TaxId: 1050]} eptaemlanncagchgtrgnsagpaspsiaqmdpavfvevmeqfksgeiqstimgriakg ystadfqkmaeyfkqqtyqp
Timeline for d3vrda1: