Lineage for d2dl2a2 (2dl2 A:102-200)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031764Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2031765Species Human (Homo sapiens), 2dl2 [TaxId:9606] [49205] (2 PDB entries)
  8. 2031769Domain d2dl2a2: 2dl2 A:102-200 [21804]

Details for d2dl2a2

PDB Entry: 2dl2 (more details), 3 Å

PDB Description: killer immunoglobulin receptor 2dl2
PDB Compounds: (A:) protein (MHC class I nk cell receptor precursor (p58 natural killer cell receptor clone cl-43))

SCOPe Domain Sequences for d2dl2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dl2a2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), 2dl2 [TaxId: 9606]}
tglyekpslsaqpgptvlagesvtlscssrssydmyhlsregeahecrfsagpkvngtfq
adfplgpathggtyrcfgsfrdspyewsnssdpllvsvi

SCOPe Domain Coordinates for d2dl2a2:

Click to download the PDB-style file with coordinates for d2dl2a2.
(The format of our PDB-style files is described here.)

Timeline for d2dl2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dl2a1