Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein Retroviral integrase, catalytic domain [53108] (4 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (44 PDB entries) |
Domain d3vqca_: 3vqc A: [218033] automated match to d2itga_ protein/DNA complex; complexed with cd, mpk, so4 |
PDB Entry: 3vqc (more details), 2.3 Å
SCOPe Domain Sequences for d3vqca_:
Sequence, based on SEQRES records: (download)
>d3vqca_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav qmavfihnhkrkggiggysagerivdiiatd
>d3vqca_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftsttvkaacdwagikqedgipsmnkelkkiigqvrdqaehlktavqmavfihnhk rkggiggysagerivdiiatd
Timeline for d3vqca_: