SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3vqca_ (3vqc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124026Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 protein domains)
  6. 2124027Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2124033Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (48 PDB entries)
  8. 2124096Domain d3vqca_: 3vqc A: [218033]
    automated match to d2itga_
    protein/DNA complex; complexed with cd, mpk, so4

Details for d3vqca_

PDB Entry: 3vqc (more details), 2.3 Å

PDB Description: hiv-1 in core domain in complex with (5-methyl-3-phenyl-1,2-oxazol-4-yl)methanol
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d3vqca_:

Sequence, based on SEQRES records: (download)

>d3vqca_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatd

Sequence, based on observed residues (ATOM records): (download)

>d3vqca_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedgipsmnkelkkiigqvrdqaehlktavqmavfihnhk
rkggiggysagerivdiiatd

SCOPe Domain Coordinates for d3vqca_:

Click to download the PDB-style file with coordinates for d3vqca_.
(The format of our PDB-style files is described here.)

Timeline for d3vqca_: