Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein Retroviral integrase, catalytic domain [53108] (4 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (73 PDB entries) |
Domain d3vqab_: 3vqa B: [218030] automated match to d2itga_ protein/DNA complex; protein/RNA complex; complexed with cd, mwp, so4, suc |
PDB Entry: 3vqa (more details), 1.9 Å
SCOPe Domain Sequences for d3vqab_:
Sequence, based on SEQRES records: (download)
>d3vqab_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav qmavfihnhkrkggiggysagerivdiiatdi
>d3vqab_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftsttvkaacdwagikqeesmnkelkkiigqvrdqaehlktavqmavfihnhkrkg giggysagerivdiiatdi
Timeline for d3vqab_: