| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Killer cell inhibitory receptor [49202] (4 species) possibly an intermediate structure between the I set and FnIII domains |
| Species Human (Homo sapiens), 2dl2 [TaxId:9606] [49205] (2 PDB entries) |
| Domain d2dl2a1: 2dl2 A:4-101 [21803] |
PDB Entry: 2dl2 (more details), 3 Å
SCOPe Domain Sequences for d2dl2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dl2a1 b.1.1.4 (A:4-101) Killer cell inhibitory receptor {Human (Homo sapiens), 2dl2 [TaxId: 9606]}
ahrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
fsigpmmqdlagtyrcygsvthspyqlsapsdpldivi
Timeline for d2dl2a1: