![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
![]() | Protein Retroviral integrase, catalytic domain [53108] (5 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries) |
![]() | Domain d3vq8a_: 3vq8 A: [218027] automated match to d1bizb_ protein/DNA complex; complexed with bcu, cd, cl, so4 |
PDB Entry: 3vq8 (more details), 1.6 Å
SCOPe Domain Sequences for d3vq8a_:
Sequence, based on SEQRES records: (download)
>d3vq8a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftgatvraacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav qmavfihnhkrkggiggysagerivdiiatdiq
>d3vq8a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftgatvraacdwagikqeesmnkelkkiigqvrdqaehlktavqmavfihnhkrkg ysagerivdiiatdiq
Timeline for d3vq8a_: