SCOPe 2.03: Domain d3vq7b_: 3vq7 B:

Lineage for d3vq7b_ (3vq7 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (37 PDB entries)

8. Domain d3vq7b_: 3vq7 B: [218026]
   automated match to d2itga_
   protein/DNA complex; complexed with cd, snu, so4, suc

Details for d3vq7b_

PDB Entry: 3vq7, 1.63 Å

PDB Description: hiv-1 in core domain in complex with 4-(1h-pyrrol-1-yl)aniline

PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d3vq7b_:

Sequence, based on SEQRES records:

>d3vq7b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d3vq7b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacdwagikqedsmnkelkkiigqvrdqaehlktavqmavfihnhkrk
ggiggysagerivdiiatdiq

Timeline for d3vq7b_:

• d3vq7b_ is new in SCOPe 2.03-stable
  
• d3vq7b_ appears in SCOPe 2.04
  
• d3vq7b_ appears in the current release, SCOPe 2.08