| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
| Protein Retroviral integrase, catalytic domain [53108] (5 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries) |
| Domain d3vq5b_: 3vq5 B: [218022] automated match to d1bizb_ protein/DNA complex; complexed with cd, cl, mmj, so4 |
PDB Entry: 3vq5 (more details), 1.7 Å
SCOPe Domain Sequences for d3vq5b_:
Sequence, based on SEQRES records: (download)
>d3vq5b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftgatvraacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatd
>d3vq5b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftgatvraacdwagikqesmnkelkkiigqvrdqaehlktavqmavfihnhkrgys
agerivdiiatd
Timeline for d3vq5b_: