Lineage for d2dlia2 (2dli A:102-200)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Killer cell inhibitory receptor [49202] (4 species)
possibly an intermediate structure between the I set and FnIII domains
Species Human (Homo sapiens), 2dl2 [TaxId:9606] [49205] (2 PDB entries) 
Domain d2dlia2: 2dli A:102-200 [21802]
Details for d2dlia2
PDB Entry: 2dli (more details), 2.9 Å
PDB Description: killer immunoglobulin receptor 2dl2,trigonal form
PDB Compounds: (A:) protein (MHC class I nk cell receptor precursor)SCOPe Domain Sequences for d2dlia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dlia2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), 2dl2 [TaxId: 9606]}
tglyekpslsaqpgptvlagesvtlscssrssydmyhlsregeahecrfsagpkvngtfq
adfplgpathggtyrcfgsfrdspyewsnssdpllvsvi
SCOPe Domain Coordinates for d2dlia2:
Click to download the PDB-style file with coordinates for d2dlia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dlia2:
- d2dlia2 first appeared (with stable ids) in SCOP 1.55
- d2dlia2 appears in SCOPe 2.07
View in 3D
