Lineage for d3vpxa2 (3vpx A:145-363)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108804Species Sporosarcina psychrophila [TaxId:1476] [226587] (1 PDB entry)
  8. 2108805Domain d3vpxa2: 3vpx A:145-363 [218016]
    Other proteins in same PDB: d3vpxa1, d3vpxb1
    automated match to d1leha1

Details for d3vpxa2

PDB Entry: 3vpx (more details), 2.55 Å

PDB Description: Crystal structure of leucine dehydrogenase from a psychrophilic bacterium Sporosarcina psychrophila.
PDB Compounds: (A:) leucine dehydrogenase

SCOPe Domain Sequences for d3vpxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpxa2 c.2.1.0 (A:145-363) automated matches {Sporosarcina psychrophila [TaxId: 1476]}
npspvtaygiyygmkaaakeafgddslagktvavqgvgnvayalceylheegakliitdi
neeavqravdafgatavgineiysqeadifapcalgaiindetipqlkakviagsannql
ketrhgdlihemgivyapdyvinsggvinvadeldgynreralkrvegiydvigkifais
krdniptyvaadrmaeeriarvantrstflqneksvlsr

SCOPe Domain Coordinates for d3vpxa2:

Click to download the PDB-style file with coordinates for d3vpxa2.
(The format of our PDB-style files is described here.)

Timeline for d3vpxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vpxa1