| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Sporosarcina psychrophila [TaxId:1476] [226587] (1 PDB entry) |
| Domain d3vpxa2: 3vpx A:145-363 [218016] Other proteins in same PDB: d3vpxa1, d3vpxb1 automated match to d1leha1 |
PDB Entry: 3vpx (more details), 2.55 Å
SCOPe Domain Sequences for d3vpxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpxa2 c.2.1.0 (A:145-363) automated matches {Sporosarcina psychrophila [TaxId: 1476]}
npspvtaygiyygmkaaakeafgddslagktvavqgvgnvayalceylheegakliitdi
neeavqravdafgatavgineiysqeadifapcalgaiindetipqlkakviagsannql
ketrhgdlihemgivyapdyvinsggvinvadeldgynreralkrvegiydvigkifais
krdniptyvaadrmaeeriarvantrstflqneksvlsr
Timeline for d3vpxa2: