![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Sporosarcina psychrophila [TaxId:1476] [226586] (1 PDB entry) |
![]() | Domain d3vpxa1: 3vpx A:1-133 [218015] Other proteins in same PDB: d3vpxa2, d3vpxb2 automated match to d1leha2 |
PDB Entry: 3vpx (more details), 2.55 Å
SCOPe Domain Sequences for d3vpxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpxa1 c.58.1.0 (A:1-133) automated matches {Sporosarcina psychrophila [TaxId: 1476]} meifkymehqdyeqlvicqdkasglkaiiaihdttlgpalggtrmwtyaseeeaiedalr largmtyknaaaglnlgggktviignpktdkndemfrafgryieglngryitaedvgtte admdlinletdyv
Timeline for d3vpxa1: