SCOPe 2.08: Domain d3vpta2: 3vpt A:76-203

Lineage for d3vpta2 (3vpt A:76-203)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries)

8. Domain d3vpta2: 3vpt A:76-203 [218014]
   Other proteins in same PDB: d3vpta1
   automated match to d1m0ua1
   complexed with peg, pg4, pgo

Details for d3vpta2

PDB Entry: 3vpt, 1.9 Å

PDB Description: Crystal structure of Bombyx mori sigma-class glutathione transferase in apo form

PDB Compounds: (A:) Glutathione S-transferase sigma

SCOPe Domain Sequences for d3vpta2:

Sequence; same for both SEQRES and ATOM records:

>d3vpta2 a.45.1.0 (A:76-203) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
lagandeeafeidqnveflndirasaasvhyekdeavkakkkaeleetkypfffeklnei
ltknnghialgkltwgdfvyagmydylkamlqkpdleqkypafrkpieavlaipkvkayv
daaprtel

Timeline for d3vpta2:

• d3vpta2 first appeared in SCOPe 2.03
  
• d3vpta2 appears in SCOPe 2.07