SCOPe 2.03: Domain d3vpta1: 3vpt A:1-75

Lineage for d3vpta1 (3vpt A:1-75)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (7 PDB entries)

8. Domain d3vpta1: 3vpt A:1-75 [218013]
   Other proteins in same PDB: d3vpta2
   automated match to d1m0ua2
   complexed with peg, pg4, pgo

Details for d3vpta1

PDB Entry: 3vpt, 1.9 Å

PDB Description: Crystal structure of Bombyx mori sigma-class glutathione transferase in apo form

PDB Compounds: (A:) Glutathione S-transferase sigma

SCOPe Domain Sequences for d3vpta1:

Sequence; same for both SEQRES and ATOM records:

>d3vpta1 c.47.1.0 (A:1-75) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
pnvkfyyfpvkalgesqrlllayggqefednrissenwpefkpktpfgqmpvleidgkqy
aqstaicrylgrkyg

Timeline for d3vpta1:

• d3vpta1 is new in SCOPe 2.03-stable
  
• d3vpta1 appears in SCOPe 2.04
  
• d3vpta1 appears in the current release, SCOPe 2.08