Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (8 PDB entries) |
Domain d3vpqa1: 3vpq A:2-76 [218011] Other proteins in same PDB: d3vpqa2 automated match to d1m0ua2 complexed with 1pe, gsh, peg, pgo |
PDB Entry: 3vpq (more details), 1.7 Å
SCOPe Domain Sequences for d3vpqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpqa1 c.47.1.0 (A:2-76) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} pnvkfyyfpvkalgesqrlllayggqefednrissenwpefkpktpfgqmpvleidgkqy aqstaicrylgrkyg
Timeline for d3vpqa1: