Lineage for d3vphd2 (3vph D:163-330)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938743Protein Lactate dehydrogenase [56339] (18 species)
  7. 1938940Species Thermus caldophilus [TaxId:272] [226615] (2 PDB entries)
  8. 1938948Domain d3vphd2: 3vph D:163-330 [218010]
    Other proteins in same PDB: d3vpha1, d3vphb1, d3vphc1, d3vphd1
    automated match to d1llda2
    complexed with fbp, gol, nad, oxm

Details for d3vphd2

PDB Entry: 3vph (more details), 2 Å

PDB Description: l-lactate dehydrogenase from thermus caldophilus gk24 complexed with oxamate, nadh and fbp
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vphd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vphd2 d.162.1.1 (D:163-330) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]}
tildtarfrallaehlrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

SCOPe Domain Coordinates for d3vphd2:

Click to download the PDB-style file with coordinates for d3vphd2.
(The format of our PDB-style files is described here.)

Timeline for d3vphd2: